PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0037s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 542aa    MW: 60027.1 Da    PI: 5.9968
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0037s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM116.42.9e-36972212126
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             +pG+rF P+d+elvv+yL kk+++++l+  + i+ev+iy+++P++L +k+k  +e+ wyfF++r kky++gk + r +  g+Wk tg
  SapurV1A.0037s0120.1.p  97 APGMRFFPKDKELVVYYLMKKIRNEPLPK-NRIHEVNIYEYHPKTLAEKYKLfQEDAWYFFTTRLKKYPKGKIPDRGVPGGFWKPTG 182
                             69************************999.77**************9655554778********************99********* PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmhey 126
                             + ++v +k+++    +++L fy+g+ ++g++t+W mhey
  SapurV1A.0037s0120.1.p 183 SPETVPAKHSNIAIERRSLDFYEGKGKTGRRTEWKMHEY 221
                             *******99****************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-4195250IPR003441NAC domain
PROSITE profilePS5100541.70696250IPR003441NAC domain
PfamPF023654.9E-1798221IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MEQNNGRSGM PSSSNGSGKK MKVAGSNYES NSNDIQFGAN ILNNASSCMF PDRFSPPNNA  60
MIAPYSPPNF VNRLYPPQHR VNGDDGNYID PYFRTFAPGM RFFPKDKELV VYYLMKKIRN  120
EPLPKNRIHE VNIYEYHPKT LAEKYKLFQE DAWYFFTTRL KKYPKGKIPD RGVPGGFWKP  180
TGSPETVPAK HSNIAIERRS LDFYEGKGKT GRRTEWKMHE YYPKTDDNVS STNTEGMRLN  240
DCVLCRIYLK GGKQQAEAKT TCNNKSRNDG NTVSHGSADS RNDDHTSSDN INSQQPANHG  300
ASASDTTEVY DETQAFYDYS MHQRWYADSS NQILASMDPA MYTLPYSRND DHTSSDNINS  360
QQPANHGASA SDTTEVYDET QAFYDYSMDQ RWYADSSNQI LASMDPAMFA FPDAIEGTSR  420
GFSQSVAFAG PSSSTPLTMN VAGMINGPSF SMPLTMHGAG LNGATSSMPL TMHVAGLNGA  480
ASSMHGAGLN GANSSKPPTT LPGNTMDADD HLVEFGSLLD DAFNDDNIAR ILEMFQQENT  540
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-299825017168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323317.20.0hypothetical protein POPTR_0016s05580g
TrEMBLB9II770.0B9II77_POPTR; Uncharacterized protein
STRINGPOPTR_0016s05580.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2307634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-37NAC-like, activated by AP3/PI